PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006761m
Common NameCARUB_v10006761mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 170aa    MW: 19527.1 Da    PI: 9.4095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006761mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-173983146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg WT+  d++l+++v+ +G ++W++Ia++m+ +Rt+k+c+ rw++
  Carubv10006761m 39 RGHWTESQDLKLKELVEAHGLENWDLIAKEMQ-TRTPKSCRVRWFN 83
                     899*****************************.***********98 PP

2Myb_DNA-binding43.85.9e-1492135247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T eE+++++  +  +G+  W++Ia+++  gR+++++k +w+ y
  Carubv10006761m  92 APFTLEEEDIIISTHSYYGNQ-WAKIAKHLK-GRSENDVKKHWNHY 135
                      68*****************99.********9.************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4933485IPR017930Myb domain
SMARTSM007171.9E-143887IPR001005SANT/Myb domain
PfamPF002492.2E-163983IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-2739132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-234092IPR009057Homeodomain-like
CDDcd001671.95E-134283No hitNo description
PROSITE profilePS5129422.05286140IPR017930Myb domain
SMARTSM007171.1E-1190138IPR001005SANT/Myb domain
PfamPF002499.8E-1392135IPR001005SANT/Myb domain
CDDcd001676.55E-993136No hitNo description
Gene3DG3DSA:1.10.10.605.0E-1993138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MESALTVFER PVNGVGANNA VPLRETQQEE IKMSAPGSRG HWTESQDLKL KELVEAHGLE  60
NWDLIAKEMQ TRTPKSCRVR WFNQVDPTLN RAPFTLEEED IIISTHSYYG NQWAKIAKHL  120
KGRSENDVKK HWNHYVNRPA WRSHTKTKKS FFTATLNPYG YHVPGLCLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26391387106B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117122KHLKGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285370.11e-126hypothetical protein CARUB_v10006761mg
TrEMBLR0H4081e-126R0H408_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17330310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39700.13e-48myb domain protein 89